General Information

  • ID:  hor000801
  • Uniprot ID:  A0A0L0C0R2
  • Protein name:  Corazonin
  • Gene name:  NA
  • Organism:  Lucilia cuprina (Green bottle fly) (Australian sheep blowfly)
  • Family:  Corazonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lucilia (genus), Luciliinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071858 corazonin receptor binding
  • GO BP:  GO:0045823 positive regulation of heart contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QTFQYSRGWTN
  • Length:  11(21-31)
  • Propeptide:  MLRIVILPLLIFLFSMACMGQTFQYSRGWTNGKRAGAATTLNNLLHNKEDDGMSELFEVQEANERRLERCLSQLQRFVRNPLLLHTTAALALNPAAPSSSQSSNSNNNMNNIPYGRNHQSNELFEELGAAGTIIDTNDYAKH
  • Signal peptide:  MLRIVILPLLIFLFSMACMG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. Clock (Clk) and cycle (cyc) proteins negatively regulate Crz transcription in a cell-specific manner.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0L0C0R2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000801_AF2.pdbhor000801_ESM.pdb

Physical Information

Mass: 156601 Formula: C62H86N18O19
Absent amino acids: ACDEHIKLMPV Common amino acids: QT
pI: 9.35 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: -154.55 Boman Index: -3507
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 713.64 Extinction Coefficient cystines: 6990
Absorbance 280nm: 699

Literature

  • PubMed ID:  23280433
  • Title:  Neuropeptidomics of the Australian Sheep Blowfly Lucilia Cuprina (Wiedemann) and Related Diptera